SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213417919|ref|NP_001132990.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213417919|ref|NP_001132990.1|
Domain Number 1 Region: 98-175
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.81e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.00013
Further Details:      
 
Domain Number 2 Region: 6-75
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.03e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0000294
Further Details:      
 
Domain Number 3 Region: 204-282
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000992
Family Double-stranded RNA-binding domain (dsRBD) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|213417919|ref|NP_001132990.1|
Sequence length 288
Comment interferon-inducible double stranded RNA-dependent protein kinase activator A isoform 3 [Homo sapiens]
Sequence
MITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGDITCTGEGTSKK
LAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEY
TLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTN
VVGHSLGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELS
ANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAHNALQYLKIIAERK
Download sequence
Identical sequences A0A2J8PRF0 A0A2J8VRE2 A0A2K5XLZ4 G1R2M7
ENSMMUP00000038089 gi|213417919|ref|NP_001132990.1| ENSP00000430604 NP_001132990.1.87134 NP_001132990.1.92137 XP_003253828.1.23891 XP_011847212.1.47321 ENSP00000430604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]