SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21361135|ref|NP_002494.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361135|ref|NP_002494.2|
Domain Number 1 Region: 52-307
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.58e-135
Family Ankyrin repeat 0.00000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21361135|ref|NP_002494.2|
Sequence length 356
Comment NF-kappa-B inhibitor beta isoform a [Homo sapiens]
Sequence
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGL
CVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALY
PDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC
GRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPE
PEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV
Download sequence
Identical sequences Q15653
ENSP00000312988 gi|21361135|ref|NP_002494.2| ENSP00000312988 ENSP00000312988 NP_002494.2.87134 NP_002494.2.92137 9606.ENSP00000312988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]