SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21361745|ref|NP_060857.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361745|ref|NP_060857.2|
Domain Number 1 Region: 505-576
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.97e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.00028
Further Details:      
 
Domain Number 2 Region: 385-455
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.52e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21361745|ref|NP_060857.2|
Sequence length 672
Comment spermatid perinuclear RNA-binding protein isoform 1 [Homo sapiens]
Sequence
MRSIRSFANDDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKTEG
ETEVKKDEAGENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNT
VKDNLPIQIQKLTEEKYQVEQCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGEN
VSMKDPPDLLDRQKCLNALASLRHAKWFQARANGLKSCVIVLRILRDLCNRVPTWAPLKG
WPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGGPGLHDPCERDPTDALSYMTI
QQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSSKPFQKYSWSVTDKEGAGSSALKRPFE
DGLGDDKDPNKKMKRNLRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTM
SVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVS
SNSSNNTGNSTTETSSTLEVRTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKR
FVMEVEVDGQKFRGAGPNKKVAKASAALAALEKLFSGPNAANNKKKKIIPQAKGVVNTAV
SAAVQAVRGRGRGTLTRGAFVGATAAPGYIAPGYGTPYGYSTAAPAYGLPKRMVLLPVMK
FPTYPVPHYSFF
Download sequence
Identical sequences A0A0D9RLX5 A0A2J8SFI7 A0A2K5QT79 A0A2K5TVU5 A0A2K6AG08 A0A2K6EA94 A0A2K6S1A2 F6WM32 K7A0Q8 Q96SI9 V9HWK4
ENSP00000321347 ENSP00000415968 ENSP00000321347 ENSP00000415968 ENSCJAP00000037238 gi|21361745|ref|NP_060857.2| ENSP00000321347 NP_060857.2.87134 NP_060857.2.92137 XP_003312319.1.37143 XP_003833191.1.60992 XP_003940697.1.74449 XP_005580876.1.63531 XP_008004523.1.81039 XP_009000914.1.60252 XP_011709605.1.29376 XP_011820887.1.47321 XP_016870383.1.92137 XP_016870384.1.92137 XP_016870385.1.92137 XP_017403856.1.71028 9598.ENSPTRP00000045202 9606.ENSP00000321347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]