SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21361792|ref|NP_542406.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|21361792|ref|NP_542406.2|
Domain Number - Region: 237-361
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000595
Family APC10-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21361792|ref|NP_542406.2|
Sequence length 379
Comment SUN domain-containing protein 5 [Homo sapiens]
Sequence
MPRSSRSPGDPGALLEDVAHNPRPRRIAQRGRNTSRMAEDTSPNMNDNILLPVRNNDQAL
GLTQCMLGCVSWFTCFACSLRTQAQQVLFNTCRCKLLCQKLMEKTGILLLCAFGFWMFSI
HLPSKMKVWQDDSINGPLQSLRLYQEKVRHHSGEIQDLRGSMNQLIAKLQEMEAMSDEQK
MAQKIMKMIHGDYIEKPDFALKSIGASIDFEHTSVTYNHEKAHSYWNWIQLWNYAQPPDV
ILEPNVTPGNCWAFEGDRGQVTIQLAQKVYLSNLTLQHIPKTISLSGSLDTAPKDFVIYG
MEGSPKEEVFLGAFQFQPENIIQMFPLQNQPARAFSAVKVKISSNWGNPGFTCLYRVRVH
GSVAPPREQPHQNPYPKRD
Download sequence
Identical sequences Q8TC36
ENSP00000348496 ENSP00000348496 NP_542406.2.87134 NP_542406.2.92137 gi|21361792|ref|NP_542406.2| ENSP00000348496 9606.ENSP00000348496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]