SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21389405|ref|NP_653204.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21389405|ref|NP_653204.1|
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily PX domain 2.29e-23
Family PX domain 0.00092
Further Details:      
 
Domain Number 2 Region: 231-288
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000021
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 160-218
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000171
Family SH3-domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21389405|ref|NP_653204.1|
Sequence length 370
Comment NADPH oxidase organizer 1 isoform a [Homo sapiens]
Sequence
MAGPRYPVSVQGAALVQIKRLQTFAFSVRWSDGSDTFVRRSWDEFRQLKTLKETFPVEAG
LLRRSDRVLPKLLDAPLLGRVGRTSRGLARLQLLETYSRRLLATAERVARSPTITGFFAP
QPLDLEPALPPGSRVILPTPEEQPLSRAAGRLSIHSLEAQSLRCLQPFCTQDTRDRPFQA
QAQESLDVLLRHPSGWWLVENEDRQTAWFPAPYLEEAAPGQGREGGPSLGSSGPQFCASR
AYESSRADELSVPAGARVRVLETSDRGWWLCRYGDRAGLLPAVLLRPEGLGALLSGTGFR
GGDDPAGEARGFPEPSQATAPPPTVPTRPSPGAIQSRCCTVTRRALERRPRRQGRPRGCV
DSVPHPTTEQ
Download sequence
Identical sequences NP_653204.1.87134 NP_653204.1.92137 ENSP00000346195 ENSP00000346195 gi|21389405|ref|NP_653204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]