SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21389427|ref|NP_653219.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21389427|ref|NP_653219.1|
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.17e-47
Family Ankyrin repeat 0.000000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21389427|ref|NP_653219.1|
Sequence length 448
Comment GA-binding protein subunit beta-2 [Homo sapiens]
Sequence
MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDWLGTSPLHLAAQYGHYSTAEVLLRA
GVSRDARTKVDRTPLHMAAADGHAHIVELLVRNGADVNAKDMLKMTALHWATERHHRDVV
ELLIKYGADVHAFSKFDKSAFDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSM
AAPFIFTSGEVVNLASLISSTNTKTTSGDPHASTVQFSNSTTSVLATLAALAEASVPLSN
SHRATANTEEIIEGNSVDSSIQQVMGSGGQRVITIVTDGVPLGNIQTSIPTGGIGQPFIV
TVQDGQQVLTVPAGKVAEETVIKEEEEEKLPLTKKPRIGEKTNSVEESKEGNERELLQQQ
LQEANRRAQEYRHQLLKKEQEAEQYRLKLEAIARQQPNGVDFTMVEEVAEVDAVVVTEGE
LEERETKVTGSAGTTEPHTRVSMATVSS
Download sequence
Identical sequences Q8TAK5
gi|21389427|ref|NP_653219.1| ENSP00000357912 ENSP00000357914 ENSP00000357914 9606.ENSP00000357914 NP_001310837.1.87134 NP_001310837.1.92137 NP_653219.1.87134 NP_653219.1.92137 XP_016855738.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]