SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21389617|ref|NP_653305.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21389617|ref|NP_653305.1|
Domain Number 1 Region: 188-502
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.01e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0061
Further Details:      
 
Domain Number 2 Region: 71-168
Classification Level Classification E-value
Superfamily ISP domain 1.57e-26
Family Rieske iron-sulfur protein (ISP) 0.028
Further Details:      
 
Domain Number 3 Region: 506-584
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 7e-21
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21389617|ref|NP_653305.1|
Sequence length 605
Comment apoptosis-inducing factor 3 isoform 1 [Homo sapiens]
Sequence
MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHP
YPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKV
MAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSK
SLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSS
PKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSV
VELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRA
DVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRK
VNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDL
EELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFVLHSKTGDMSWL
TGKGS
Download sequence
Identical sequences Q96NN9
ENSP00000327671 HR6848 9606.ENSP00000335369 NP_653305.1.87134 NP_653305.1.92137 ENSP00000382120 ENSP00000390798 gi|21389617|ref|NP_653305.1| ENSP00000382120 ENSP00000390798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]