SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21450675|ref|NP_659416.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21450675|ref|NP_659416.1|
Domain Number 1 Region: 33-136
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.27e-23
Family Canonical RBD 0.0055
Further Details:      
 
Domain Number 2 Region: 229-324
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-20
Family Canonical RBD 0.0001
Further Details:      
 
Domain Number 3 Region: 141-228
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.79e-19
Family Canonical RBD 0.0000212
Further Details:      
 
Weak hits

Sequence:  gi|21450675|ref|NP_659416.1|
Domain Number - Region: 391-467
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00698
Family Double-stranded RNA-binding domain (dsRBD) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21450675|ref|NP_659416.1|
Sequence length 533
Comment probable RNA-binding protein 46 [Homo sapiens]
Sequence
MNEENIDGTNGCSKVRTGIQNEAALLALMEKTGYNMVQENGQRKFGGPPPGWEGPPPPRG
CEVFVGKIPRDMYEDELVPVFERAGKIYEFRLMMEFSGENRGYAFVMYTTKEEAQLAIRI
LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVDVIVYPSATDK
TKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWADPEKEVDEETMQRVKVLYV
RNLMISTTEETIKAEFNKFKPGAVERVKKLRDYAFVHFFNREDAVAAMSVMNGKCIDGAS
IEVTLAKPVNKENTWRQHLNGQISPNSENLIVFANKEESHPKTLGKLPTLPARLNGQHSP
SPPEVERCTYPFYPGTKLTPISMYSLKSNHFNSAVMHLDYYCNKNNWAPPEYYLYSTTSQ
DGKVLLVYKIVIPAIANGSQSYFMPDKLCTTLEDAKELAAQFTLLHLDYNFHRSSINSLS
PVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQASFF
Download sequence
Identical sequences Q8TBY0
gi|21450675|ref|NP_659416.1| ENSP00000281722 NP_659416.1.87134 NP_659416.1.92137 XP_011529994.1.92137 XP_011529995.1.92137 XP_011529996.1.92137 XP_011529997.1.92137 XP_011529998.1.92137 ENSP00000281722 9606.ENSP00000281722 GO.81819 ENSP00000424500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]