SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21450785|ref|NP_004223.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21450785|ref|NP_004223.2|
Domain Number 1 Region: 374-494
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-27
Family SH2 domain 0.00043
Further Details:      
 
Domain Number 2 Region: 497-535
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000109
Family SOCS box-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21450785|ref|NP_004223.2|
Sequence length 535
Comment suppressor of cytokine signaling 6 [Homo sapiens]
Sequence
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGED
EKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQS
ETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSY
CLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
RAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Download sequence
Identical sequences A0A024R379 O14544
gi|21450785|ref|NP_004223.2| ENSP00000381034 ENSP00000381034 ENSP00000463395 ENSP00000381034 ENSP00000463395 NP_004223.2.87134 NP_004223.2.92137 XP_005266840.1.92137 XP_016881575.1.92137 XP_016881576.1.92137 9606.ENSP00000306939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]