SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|214829673|ref|NP_055385.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|214829673|ref|NP_055385.3|
Domain Number 1 Region: 12-114
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.98e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|214829673|ref|NP_055385.3|
Sequence length 516
Comment ADP-ribosylation factor GTPase-activating protein 3 isoform 1 [Homo sapiens]
Sequence
MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSL
ASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPV
ETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANT
CFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNV
DSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSSYFDEP
VELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK
FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLP
NAPDMAQFKQGVRSVAGKLSVFANGVVTSIQDRYGS
Download sequence
Identical sequences A0A024R4U0 Q9NP61
NP_055385.3.87134 NP_055385.3.92137 gi|214829673|ref|NP_055385.3| 9606.ENSP00000263245 ENSP00000263245 ENSP00000263245 ENSP00000263245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]