SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|215272410|ref|NP_001135805.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|215272410|ref|NP_001135805.1|
Domain Number 1 Region: 96-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-26
Family Canonical RBD 0.00000952
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|215272410|ref|NP_001135805.1|
Sequence length 370
Comment RNA binding protein fox-1 homolog 1 isoform 5 [Homo sapiens]
Sequence
MNCEREQLRGNQEAAAAPDTMAQPYASAQFAPPQNGIPAEYTAPHPHPAPEYTGQTTVPE
HTLNLYPPAQTHSEQSPADTSAQTVSGTATQTDDAAPTDGQPQTQPSENTENKSQPKRLH
VSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTV
VEGRKIEVNNATARVMTNKKTVNPYTNGWKLNPVVGAVYSPEFYAVPGFPYPAATAAAAY
RGAHLRGRGRTVYNTFRAAAPPPPIPAYGGVVYQDGFYGADIYGGYAAYRYAQPTPATAA
AYSDSYGRVYAADPYHHALAPAPTYGVGAMNAFAPLTDAKTRSHADDVGLVLSSLQASIY
RGGYNRFAPY
Download sequence
Identical sequences A0A2J8LAB3 A0A2J8SEX0
NP_001135805.1.87134 NP_001135805.1.92137 XP_003808362.1.60992 XP_010352173.1.97406 XP_011816759.1.43180 XP_011885842.1.92194 XP_016878827.1.92137 XP_018867814.1.27298 ENSP00000447753 gi|215272410|ref|NP_001135805.1| ENSP00000447753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]