SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|215422383|ref|NP_001135867.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|215422383|ref|NP_001135867.1|
Domain Number 1 Region: 20-76
Classification Level Classification E-value
Superfamily GLA-domain 3.03e-21
Family GLA-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|215422383|ref|NP_001135867.1|
Sequence length 218
Comment transmembrane gamma-carboxyglutamic acid protein 1 isoform 1 precursor [Homo sapiens]
Sequence
MGRVFLTGEKANSILKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREAFENNEKTKEF
WSTYTKAQQGESNRGSDWFQFYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHI
PFPQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVN
LQRSETEPHLDPPPEYEDIVNSNSASAIPMVPVVTTIK
Download sequence
Identical sequences G1QJH1 O14668
ENSP00000367894 ENSP00000390332 ENSP00000443271 ENSP00000444278 ENSP00000469094 ENSP00000469699 ENSP00000470278 ENSP00000472527 ENSP00000367894 9606.ENSP00000367894 ENSNLEP00000001065 NP_000941.1.87134 NP_000941.1.92137 NP_001135867.1.87134 NP_001135867.1.92137 NP_001166960.1.87134 NP_001166960.1.92137 NP_001166961.1.87134 NP_001166961.1.92137 XP_003271025.1.23891 XP_003271026.1.23891 XP_003271028.1.23891 ENSNLEP00000001065 ENSP00000367894 ENSP00000390332 ENSP00000443271 ENSP00000444278 gi|215422383|ref|NP_001135867.1| gi|291045212|ref|NP_001166961.1| gi|291219878|ref|NP_001166960.1| gi|4506135|ref|NP_000941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]