SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21618327|ref|NP_036320.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21618327|ref|NP_036320.2|
Domain Number 1 Region: 122-217
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.77e-40
Family Forkhead DNA-binding domain 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21618327|ref|NP_036320.2|
Sequence length 378
Comment forkhead box protein I1 isoform a [Homo sapiens]
Sequence
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPN
PYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMK
LVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDC
FKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDVSSSTASLALEKTESSLPV
DSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGAPCLNSFLSSMTAYVSGGSPTSHPLV
TPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHF
YNSVNTSGVLYPREGTEV
Download sequence
Identical sequences E0XEN6 Q12951
9606.ENSP00000304286 NP_036320.2.87134 NP_036320.2.92137 ENSP00000304286 gi|21618327|ref|NP_036320.2| ENSP00000304286 ENSP00000304286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]