SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21624607|ref|NP_066972.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21624607|ref|NP_066972.1|
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.86e-43
Family Cofilin-like 0.000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21624607|ref|NP_066972.1|
Sequence length 142
Comment coactosin-like protein [Homo sapiens]
Sequence
MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFA
FVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL
EEDFIKSELKKAGGANYDAQTE
Download sequence
Identical sequences H2RA06 Q14019
ENSP00000262428 gi|21624607|ref|NP_066972.1| NP_066972.1.87134 NP_066972.1.92137 XP_016785780.1.37143 9606.ENSP00000262428 ENSP00000262428 d1wnja1 ENSP00000262428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]