SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21717826|ref|NP_663629.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21717826|ref|NP_663629.1|
Domain Number 1 Region: 63-265
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.91e-35
Family The homologous-pairing domain of Rad52 recombinase 0.035
Further Details:      
 
Domain Number 2 Region: 11-86
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000436
Family Canonical RBD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21717826|ref|NP_663629.1|
Sequence length 284
Comment RAD52 motif-containing protein 1 isoform 1 [Homo sapiens]
Sequence
MAELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPG
FYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANY
YFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLV
EEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGV
RCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD
Download sequence
Identical sequences Q8NG50
9606.ENSP00000293273 ENSP00000293273 NP_663629.1.87134 NP_663629.1.92137 GO.100475 ENSP00000481061 ENSP00000483549 ENSP00000293273 ENSP00000474510 gi|21717826|ref|NP_663629.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]