SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|217416350|ref|NP_001136115.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217416350|ref|NP_001136115.1|
Domain Number 1 Region: 2-182
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.28e-47
Family Ankyrin repeat 0.0000501
Further Details:      
 
Domain Number 2 Region: 471-540
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.55e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 402-467
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.36e-16
Family SAM (sterile alpha motif) domain 0.0043
Further Details:      
 
Domain Number 4 Region: 185-264
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000021
Family SH3-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217416350|ref|NP_001136115.1|
Sequence length 1120
Comment caskin-2 isoform b [Homo sapiens]
Sequence
MRPLHYAAWQGRLEPVRLLLRASAAVNAASLDGQIPLHLAAQYGHYEVSEMLLQHQSNPC
LVNKAKKTPLDLACEFGRLKVAQLLLNSHLCVALLEGEAKDPCDPNYTTPLHLAAKNGHR
EVIRQLLRAGIEINRQTKTGTALHEAALYGKTEVVRLLLEGGVDVNIRNTYNQTALDIVN
QFTTSQASREIKQLLREASGILKVRALKDFWNLHDPTALNVRAGDVITVLEQHPDGRWKG
HIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAPTPLRPGFSRTPQPPAEEPPHPL
TYSQLPRVGLSPDSPAGDRNSVGSEGSVGSIRSAGSGQSSEGTNGHGPGLLIENAQPLPS
AGEDQVLPGLHPPSLADNLSHRPLANCRSGEQIFTQDVRPEQLLEGKDAQAIHNWLSEFQ
LEGYTAHFLQAGYDVPTISRMTPEDLTAIGVTKPGHRKKIASEIAQLSIAEWLPSYIPTD
LLEWLCALGLPQYHKQLVSSGYDSMGLVADLTWEELQEIGVNKLGHQKKLMLGVKRLAEL
RRGLLQGEALSEGGRRLAKGPELMAIEGLENGEGPATAGPRLLTFQGSELSPELQAAMAG
GGPEPLPLPPARSPSQESIGARSRGSGHSQEQPAPQPSGGDPSPPQERNLPEGTERPPKL
CSSLPGQGPPPYVFMYPQGSPSSPAPGPPPGAPWAFSYLAGPPATPPDPPRPKRRSHSLS
RPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR
ARRKGPPPPPPKRLSSVSGPSPEPPPLDESPGPKEGATGPRRRTLSEPAGPSEPPGPPAP
AGPASDTEEEEPGPEGTPPSRGSSGEGLPFAEEGNLTIKQRPKPAGPPPRETPVPPGLDF
NLTESDTVKRRPKCREREPLQTALLAFGVASATPGPAAPLPSPTPGESPPASSLPQPEPS
SLPAQGVPTPLAPSPAMQPPVPPCPGPGLESSAASRWNGETEPPAAPAALLKVPGAGTAP
KPVSVACTQLAFSGPKLAPRLGPRPVPPPRPESTGTVGPGQAQQRLEQTSSSLAAALRAA
EKSIGTKEQEGTPSASTKHILDDISTMFDALADQLDAMLD
Download sequence
Identical sequences NP_001136115.1.87134 NP_001136115.1.92137 ENSP00000406963 gi|217416350|ref|NP_001136115.1| ENSP00000406963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]