SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219842259|ref|NP_009054.5| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219842259|ref|NP_009054.5|
Domain Number 1 Region: 1054-1243
Classification Level Classification E-value
Superfamily Fibronectin type III 8.07e-31
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 2 Region: 1243-1288,1319-1409
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-25
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 3 Region: 119-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-18
Family Clostridium neurotoxins, the second last domain 0.084
Further Details:      
 
Domain Number 4 Region: 1424-1508
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000248
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 5 Region: 641-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 6 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 7 Region: 900-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 8 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 9 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 10 Region: 747-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 11 Region: 575-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 12 Region: 1002-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 13 Region: 951-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000137
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 14 Region: 518-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Laminin-type module 0.046
Further Details:      
 
Weak hits

Sequence:  gi|219842259|ref|NP_009054.5|
Domain Number - Region: 339-415
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00559
Family beta-mannanase CBM 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219842259|ref|NP_009054.5|
Sequence length 1546
Comment usherin isoform A [Homo sapiens]
Sequence
MNCPVLSLGSGFLFQVIEMLIFAYFASISLTESRGLFPRLENVGAFKKVSIVPTQAVCGL
PDRSTFCHSSAAAESIQFCTQRFCIQDCPYRSSHPTYTALFSAGLSSCITPDKNDLHPNA
HSNSASFIFGNHKSCFSSPPSPKLMASFTLAVWLKPEQQGVMCVIEKTVDGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHQTKISFFINGVEKDHTPFNAR
TLSGSITDFASGTVQIGQSLNGLEQFVGRMQDFRLYQVALTNREILEVFSGDLLRLHAQS
HCRCPGSHPRVHPLAQRYCIPNDAGDTADNRVSRLNPEAHPLSFVNDNDVGTSWVSNVFT
NITQLNQGVTISVDLENGQYQVFYIIIQFFSPQPTEIRIQRKKENSLDWEDWQYFARNCG
AFGMKNNGDLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNNFYNTPSLQEFV
KATQIRFHFHGQYYTTETAVNLRHRYYAVDEITISGRCQCHGHADNCDTTSQPYRCLCSQ
ESFTEGLHCDRCLPLYNDKPFRQGDQVYAFNCKPCQCNSHSKSCHYNISVDPFPFEHFRG
GGGVCDDCEHNTTGRNCELCKDYFFRQVGADPSAIDVCKPCDCDTVGTRNGSILCDQIGG
QCNCKRHVSGRQCNQCQNGFYNLQELDPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKAN
VIGLRCDHCNFGFKFLRSFNDVGCEPCQCNLHGSVNKFCNPHSGQCECKKEAKGLQCDTC
RENFYGLDVTNCKACDCDTAGSLPGTVCNAKTGQCICKPNVEGRQCNKCLEGNFYLRQNN
SFLCLPCNCDKTGTINGSLLCNKSTGQCPCKLGVTGLRCNQCEPHRYNLTIDNFQHCQMC
ECDSLGTLPGTICDPISGQCLCVPNRQGRRCNQCQPGFYISPGNATGCLPCSCHTTGAVN
HICNSLTGQCVCQDASIAGQRCDQCKDHYFGFDPQTGRCQPCNCHLSGALNETCHLVTGQ
CFCKQFVTGSKCDACVPSASHLDVNNLLGCSKTPFQQPPPRGQVQSSSAINLSWSPPDSP
NAHWLTYSLLRDGFEIYTTEDQYPYSIQYFLDTDLLPYTKYSYYIETTNVHGSTRSVAVT
YKTKPGVPEGNLTLSYIIPIGSDSVTLTWTTLSNQSGPIEKYILSCAPLAGGQPCVSYEG
HETSATIWNLVPFAKYDFSVQACTSGGCLHSLPITVTTAQAPPQRLSPPKMQKISSTELH
VEWSPPAELNGIIIRYELYMRRLRSTKETTSEESRVFQSSGWLSPHSFVESANENALKPP
QTMTTITGLEPYTKYEFRVLAVNMAGSVSSAWVSERTGESAPVFMIPPSVFPLSSYSLNI
SWEKPADNVTRGKVVGYDINMLSEQSPQQSIPMAFSQLLHTAKSQELSYTVEGLKPYRIY
EFTITLCNSVGCVTSASGAGQTLAAAPAQLRPPLVKGINSTTIHLKWFPPEELNGPSPIY
QLERRESSLPALMTTMMKGIRFIGNGYCKFPSSTHPVNTDFTGKCV
Download sequence
Identical sequences NP_009054.5.87134 NP_009054.5.92137 gi|219842259|ref|NP_009054.5|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]