SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219842266|ref|NP_996816.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219842266|ref|NP_996816.2|
Domain Number 1 Region: 3873-4066
Classification Level Classification E-value
Superfamily Fibronectin type III 3.83e-37
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 4529-4735
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-36
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 3 Region: 4268-4443
Classification Level Classification E-value
Superfamily Fibronectin type III 4.55e-33
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 1243-1288,1319-1452
Classification Level Classification E-value
Superfamily Fibronectin type III 3.33e-32
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 5 Region: 2531-2674
Classification Level Classification E-value
Superfamily Fibronectin type III 1.78e-31
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 6 Region: 4732-4932
Classification Level Classification E-value
Superfamily Fibronectin type III 6.28e-31
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 7 Region: 1054-1243
Classification Level Classification E-value
Superfamily Fibronectin type III 3.99e-30
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 8 Region: 1707-1895
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.24e-30
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 1518-1695
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-29
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 10 Region: 2142-2329
Classification Level Classification E-value
Superfamily Fibronectin type III 3.33e-28
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 11 Region: 2329-2533
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-28
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 12 Region: 2819-3005
Classification Level Classification E-value
Superfamily Fibronectin type III 8.74e-28
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 13 Region: 3589-3719
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-25
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 14 Region: 1982-2143
Classification Level Classification E-value
Superfamily Fibronectin type III 1.76e-25
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 15 Region: 3688-3867
Classification Level Classification E-value
Superfamily Fibronectin type III 1.91e-24
Family Fibronectin type III 0.0065
Further Details:      
 
Domain Number 16 Region: 3456-3587
Classification Level Classification E-value
Superfamily Fibronectin type III 4.52e-24
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 17 Region: 2688-2821
Classification Level Classification E-value
Superfamily Fibronectin type III 9.94e-22
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 18 Region: 3020-3149
Classification Level Classification E-value
Superfamily Fibronectin type III 8.58e-21
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 19 Region: 4024-4155
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-20
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 20 Region: 119-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.04e-18
Family Clostridium neurotoxins, the second last domain 0.084
Further Details:      
 
Domain Number 21 Region: 4149-4264
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-17
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 22 Region: 4430-4540
Classification Level Classification E-value
Superfamily Fibronectin type III 6e-16
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 23 Region: 1461-1527,1904-1955
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000141
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 24 Region: 641-691
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 25 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000024
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 26 Region: 900-942
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000206
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 27 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 28 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 29 Region: 747-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 30 Region: 575-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 31 Region: 1002-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 32 Region: 951-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Laminin-type module 0.0084
Further Details:      
 
Weak hits

Sequence:  gi|219842266|ref|NP_996816.2|
Domain Number - Region: 518-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 339-415
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00935
Family beta-mannanase CBM 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219842266|ref|NP_996816.2|
Sequence length 5202
Comment usherin isoform B [Homo sapiens]
Sequence
MNCPVLSLGSGFLFQVIEMLIFAYFASISLTESRGLFPRLENVGAFKKVSIVPTQAVCGL
PDRSTFCHSSAAAESIQFCTQRFCIQDCPYRSSHPTYTALFSAGLSSCITPDKNDLHPNA
HSNSASFIFGNHKSCFSSPPSPKLMASFTLAVWLKPEQQGVMCVIEKTVDGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHQTKISFFINGVEKDHTPFNAR
TLSGSITDFASGTVQIGQSLNGLEQFVGRMQDFRLYQVALTNREILEVFSGDLLRLHAQS
HCRCPGSHPRVHPLAQRYCIPNDAGDTADNRVSRLNPEAHPLSFVNDNDVGTSWVSNVFT
NITQLNQGVTISVDLENGQYQVFYIIIQFFSPQPTEIRIQRKKENSLDWEDWQYFARNCG
AFGMKNNGDLEKPDSVNCLQLSNFTPYSRGNVTFSILTPGPNYRPGYNNFYNTPSLQEFV
KATQIRFHFHGQYYTTETAVNLRHRYYAVDEITISGRCQCHGHADNCDTTSQPYRCLCSQ
ESFTEGLHCDRCLPLYNDKPFRQGDQVYAFNCKPCQCNSHSKSCHYNISVDPFPFEHFRG
GGGVCDDCEHNTTGRNCELCKDYFFRQVGADPSAIDVCKPCDCDTVGTRNGSILCDQIGG
QCNCKRHVSGRQCNQCQNGFYNLQELDPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKAN
VIGLRCDHCNFGFKFLRSFNDVGCEPCQCNLHGSVNKFCNPHSGQCECKKEAKGLQCDTC
RENFYGLDVTNCKACDCDTAGSLPGTVCNAKTGQCICKPNVEGRQCNKCLEGNFYLRQNN
SFLCLPCNCDKTGTINGSLLCNKSTGQCPCKLGVTGLRCNQCEPHRYNLTIDNFQHCQMC
ECDSLGTLPGTICDPISGQCLCVPNRQGRRCNQCQPGFYISPGNATGCLPCSCHTTGAVN
HICNSLTGQCVCQDASIAGQRCDQCKDHYFGFDPQTGRCQPCNCHLSGALNETCHLVTGQ
CFCKQFVTGSKCDACVPSASHLDVNNLLGCSKTPFQQPPPRGQVQSSSAINLSWSPPDSP
NAHWLTYSLLRDGFEIYTTEDQYPYSIQYFLDTDLLPYTKYSYYIETTNVHGSTRSVAVT
YKTKPGVPEGNLTLSYIIPIGSDSVTLTWTTLSNQSGPIEKYILSCAPLAGGQPCVSYEG
HETSATIWNLVPFAKYDFSVQACTSGGCLHSLPITVTTAQAPPQRLSPPKMQKISSTELH
VEWSPPAELNGIIIRYELYMRRLRSTKETTSEESRVFQSSGWLSPHSFVESANENALKPP
QTMTTITGLEPYTKYEFRVLAVNMAGSVSSAWVSERTGESAPVFMIPPSVFPLSSYSLNI
SWEKPADNVTRGKVVGYDINMLSEQSPQQSIPMAFSQLLHTAKSQELSYTVEGLKPYRIY
EFTITLCNSVGCVTSASGAGQTLAAAPAQLRPPLVKGINSTTIHLKWFPPEELNGPSPIY
QLERRESSLPALMTTMMKGIRFIGNGYCKFPSSTHPVNTDFTGIKASFRTKVPEGLIVFA
ASPGNQEEYFALQLKKGRLYFLFDPQGSPVEVTTTNDHGKQYSDGKWHEIIAIRHQAFGQ
ITLDGIYTGSSAILNGSTVIGDNTGVFLGGLPRSYTILRKDPEIIQKGFVGCLKDVHFMK
NYNPSAIWEPLDWQSSEEQINVYNSWEGCPASLNEGAQFLGAGFLELHPYMFHGGMNFEI
SFKFRTDQLNGLLLFVYNKDGPDFLAMELKSGILTFRLNTSLAFTQVDLLLGLSYCNGKW
NKVIIKKEGSFISASVNGLMKHASESGDQPLVVNSPVYVGGIPQELLNSYQHLCLEQGFG
GCMKDVKFTRGAVVNLASVSSGAVRVNLDGCLSTDSAVNCRGNDSILVYQGKEQSVYEGG
LQPFTEYLYRVIASHEGGSVYSDWSRGRTTGAAPQSVPTPSRVRSLNGYSIEVTWDEPVV
RGVIEKYILKAYSEDSTRPPRMPSASAEFVNTSNLTGILTGLLPFKNYAVTLTACTLAGC
TESSHALNISTPQEAPQEVQPPVAKSLPSSLLLSWNPPKKANGIITQYCLYMDGRLIYSG
SEENYTVTDLAVFTPHQFLLSACTHVGCTNSSWVLLYTAQLPPEHVDSPVLTVLDSRTIH
IQWKQPRKISGILERYVLYMSNHTHDFTIWSVIYNSTELFQDHMLQYVLPGNKYLIKLGA
CTGGGCTVSEASEALTDEDIPEGVPAPKAHSYSPDSFNVSWTEPEYPNGVITSYGLYLDG
ILIHNSSELSYRAYGFAPWSLHSFRVQACTAKGCALGPLVENRTLEAPPEGTVNVFVKTQ
GSRKAHVRWEAPFRPNGLLTHSVLFTGIFYVDPVGNNYTLLNVTKVMYSGEETNLWVLID
GLVPFTNYTVQVNISNSQGSLITDPITIAMPPGAPDGVLPPRLSSATPTSLQVVWSTPAR
NNAPGSPRYQLQMRSGDSTHGFLELFSNPSASLSYEVSDLQPYTEYMFRLVASNGFGSAH
SSWIPFMTAEDKPGPVVPPILLDVKSRMMLVTWQHPRKSNGVITHYNIYLHGRLYLRTPG
NVTNCTVMHLHPYTAYKFQVEACTSKGCSLSPESQTVWTLPGAPEGIPSPELFSDTPTSV
IISWQPPTHPNGLVENFTIERRVKGKEEVTTLVTLPRSHSMRFIDKTSALSPWTKYEYRV
LMSTLHGGTNSSAWVEVTTRPSRPAGVQPPVVTVLEPDAVQVTWKPPLIQNGDILSYEIH
MPDPHITLTNVTSAVLSQKVTHLIPFTNYSVTIVACSGGNGYLGGCTESLPTYVTTHPTV
PQNVGPLSVIPLSESYVVISWQPPSKPNGPNLRYELLRRKIQQPLASNPPEDLNRWHNIY
SGTQWLYEDKGLSRFTTYEYMLFVHNSVGFTPSREVTVTTLAGLPERGANLTASVLNHTA
IDVRWAKPTVQDLQGEVEYYTLFWSSATSNDSLKILPDVNSHVIGHLKPNTEYWIFISVF
NGVHSINSAGLHATTCDGEPQGMLPPEVVIINSTAVRVIWTSPSNPNGVVTEYSIYVNNK
LYKTGMNVPGSFILRDLSPFTIYDIQVEVCTIYACVKSNGTQITTVEDTPSDIPTPTIRG
ITSRSLQIDWVSPRKPNGIILGYDLLWKTWYPCAKTQKLVQDQSDELCKAVRCQKPESIC
GHICYSSEAKVCCNGVLYNPKPGHRCCEEKYIPFVLNSTGVCCGGRIQEAQPNHQCCSGY
YARILPGEVCCPDEQHNRVSVGIGDSCCGRMPYSTSGNQICCAGRLHDGHGQKCCGRQIV
SNDLECCGGEEGVVYNRLPGMFCCGQDYVNMSDTICCSASSGESKAHIKKNDPVPVKCCE
TELIPKSQKCCNGVGYNPLKYVCSDKISTGMMMKETKECRILCPASMEATEHCGRCDFNF
TSHICTVIRGSHNSTGKASIEEMCSSAEETIHTGSVNTYSYTDVNLKPYMTYEYRISAWN
SYGRGLSKAVRARTKEDVPQGVSPPTWTKIDNLEDTIVLNWRKPIQSNGPIIYYILLRNG
IERFRGTSLSFSDKEGIQPFQEYSYQLKACTVAGCATSSKVVAATTQGVPESILPPSITA
LSAVALHLSWSVPEKSNGVIKEYQIRQVGKGLIHTDTTDRRQHTVTGLQPYTNYSFTLTA
CTSAGCTSSEPFLGQTLQAAPEGVWVTPRHIIINSTTVELYWSLPEKPNGLVSQYQLSRN
GNLLFLGGSEEQNFTDKNLEPNSRYTYKLEVKTGGGSSASDDYIVQTPMSTPEEIYPPYN
ITVIGPYSIFVAWIPPGILIPEIPVEYNVLLNDGSVTPLAFSVGHHQSTLLENLTPFTQY
EIRIQACQNGSCGVSSRMFVKTPEAAPMDLNSPVLKALGSACIEIKWMPPEKPNGIIINY
FIYRRPAGIEEESVLFVWSEGALEFMDEGDTLRPFTLYEYRVRACNSKGSVESLWSLTQT
LEAPPQDFPAPWAQATSAHSVLLNWTKPESPNGIISHYRVVYQERPDDPTFNSPTVHAFT
VKGTSHQAHLYGLEPFTTYRIGVVAANHAGEILSPWTLIQTLESSPSGLRNFIVEQKENG
RALLLQWSEPMRTNGVIKTYNIFSDGFLEYSGLNRQFLFRRLDPFTLYTLTLEACTRAGC
AHSAPQPLWTDEAPPDSQLAPTVHSVKSTSVELSWSEPVNPNGKIIRYEVIRRCFEGKAW
GNQTIQADEKIVFTEYNTERNTFMYNDTGLQPWTQCEYKIYTWNSAGHTCSSWNVVRTLQ
APPEGLSPPVISYVSMNPQKLLISWIPPEQSNGIIQSYRLQRNEMLYPFSFDPVTFNYTD
EELLPFSTYSYALQACTSGGCSTSKPTSITTLEAAPSEVSPPDLWAVSATQMNVCWSPPT
VQNGKITKYLVRYDNKESLAGQGLCLLVSHLQPYSQYNFSLVACTNGGCTASVSKSAWTM
EALPENMDSPTLQVTGSESIEITWKPPRNPNGQIRSYELRRDGTIVYTGLETRYRDFTLT
PGVEYSYTVTASNSQGGILSPLVKDRTSPSAPSGMEPPKLQARGPQEILVNWDPPVRTNG
DIINYTLFIRELFERETKIIHINTTHNSFGMQSYIVNQLKPFHRYEIRIQACTTLGCASS
DWTFIQTPEIAPLMQPPPHLEVQMAPGGFQPTVSLLWTGPLQPNGKVLYYELYRRQIATQ
PRKSNPVLIYNGSSTSFIDSELLPFTEYEYQVWAVNSAGKAPSSWTWCRTGPAPPEGLRA
PTFHVISSTQAVVNISAPGKPNGIVSLYRLFSSSAHGAETVLSEGMATQQTLHGLQAFTN
YSIGVEACTCFNCCSKGPTAELRTHPAPPSGLSSPQIGTLASRTASFRWSPPMFPNGVIH
SYELQFHVACPPDSALPCTPSQIETKYTGLGQKASLGGLQPYTTYKLRVVAHNEVGSTAS
EWISFTTQKELPQYRAPFSVDSNLSVVCVNWSDTFLLNGQLKEYVLTDGGRRVYSGLDTT
LYIPRTADKTFFFQVICTTDEGSVKTPLIQYDTSTGLGLVLTTPGKKKGSRSKSTEFYSE
LWFIVLMAMLGLILLAIFLSLILQRKIHKEPYIRERPPLVPLQKRMSPLNVYPPGENHMG
LADTKIPRSGTPVSIRSNRSACVLRIPSQNQTSLTYSQGSLHRSVSQLMDIQDKKVLMDN
SLWEAIMGHNSGLYVDEEDLMNAIKDFSSVTKERTTFTDTHL
Download sequence
Identical sequences NP_996816.2.87134 NP_996816.2.92137 gi|219842266|ref|NP_996816.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]