SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22035672|ref|NP_006431.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22035672|ref|NP_006431.2|
Domain Number 1 Region: 37-384
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.37e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000097
Further Details:      
 
Domain Number 2 Region: 392-523
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.64e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22035672|ref|NP_006431.2|
Sequence length 524
Comment thioredoxin reductase 2, mitochondrial precursor [Homo sapiens]
Sequence
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQ
LGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQP
VPHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS
ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDST
TGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDV
VEGRPELTPIAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHG
QEHVEVYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLVLGLHFLGPNAGEVTQGFALG
IKCGASYAQVMRTVGIHPTCSEEVVKLRISKRSGLDPTVTGCUG
Download sequence
Identical sequences Q9NNW7
ENSP00000383362 NP_006431.2.87134 NP_006431.2.92137 ENSP00000383365 gi|22035672|ref|NP_006431.2| ENSP00000383365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]