SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22091454|ref|NP_665683.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22091454|ref|NP_665683.1|
Domain Number 1 Region: 81-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.08e-45
Family Glutathione S-transferase (GST), C-terminal domain 0.0000527
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-31
Family Glutathione S-transferase (GST), N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22091454|ref|NP_665683.1|
Sequence length 222
Comment glutathione S-transferase A1 [Homo sapiens]
Sequence
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
Download sequence
Identical sequences A0A140VJK4 P08263
1pl1A 1pkw_A 1pkw_B 1pkz_A 1pkz_B 1pl1_A 1pl1_B ENSP00000335620 NP_665683.1.87134 NP_665683.1.92137 gi|22091454|ref|NP_665683.1| 9606.ENSP00000335620 ENSP00000335620 ENSP00000335620 400154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]