SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221139714|ref|NP_115876.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221139714|ref|NP_115876.3|
Domain Number 1 Region: 145-372
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.91e-76
Family Actin/HSP70 0.000000318
Further Details:      
 
Domain Number 2 Region: 7-152
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.5e-47
Family Actin/HSP70 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|221139714|ref|NP_115876.3|
Sequence length 372
Comment actin-related protein M1 [Homo sapiens]
Sequence
MNHCQLPVVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDW
RSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITE
MFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLA
GLDLTNYLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMAKKPDCLEKVYQLP
DGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSSIMKCDTGLRNSFFSNIILAGGS
TSFPGLDKRLVKDIAKVAPANTAVQVIAPPERKISVWMGGSILASLSAFQDMWITAAEFK
EVGPNIVHQRCF
Download sequence
Identical sequences Q9BYD9
ENSP00000333037 gi|221139714|ref|NP_115876.3| 9606.ENSP00000333037 ENSP00000333037 ENSP00000333037 NP_115876.3.87134 NP_115876.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]