SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|221307578|ref|NP_001138297.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221307578|ref|NP_001138297.1|
Domain Number 1 Region: 26-193
Classification Level Classification E-value
Superfamily RUN domain-like 4.58e-43
Family RUN domain 0.0000553
Further Details:      
 
Weak hits

Sequence:  gi|221307578|ref|NP_001138297.1|
Domain Number - Region: 250-318
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0654
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221307578|ref|NP_001138297.1|
Sequence length 446
Comment RUN domain-containing protein 3A isoform 1 [Homo sapiens]
Sequence
MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEQILSHRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENIST
ARAKGRAWIRVALMEKRMSEYITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAI
DFSFCLKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPL
VTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQN
QREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSK
LYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGKDPTPSMLGLCGSLASIPSC
KSLASFKSNECLVSDSPEGSPALSPS
Download sequence
Identical sequences H2RHZ7 Q59EK9
NP_001138297.1.87134 NP_001138297.1.92137 XP_008010616.1.81039 XP_011717957.1.29376 XP_011841298.1.47321 XP_011914098.1.92194 XP_014975345.1.72884 XP_016787146.1.37143 ENSP00000225441 ENSP00000410862 9606.ENSP00000410862 ENSP00000410862 gi|221307578|ref|NP_001138297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]