SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221316650|ref|NP_005223.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221316650|ref|NP_005223.4|
Domain Number 1 Region: 625-919
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-79
Family Protein kinases, catalytic subunit 0.0000000389
Further Details:      
 
Domain Number 2 Region: 27-202
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-55
Family Ephrin receptor ligand binding domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 331-537
Classification Level Classification E-value
Superfamily Fibronectin type III 6.77e-24
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 4 Region: 908-975
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.85e-20
Family SAM (sterile alpha motif) domain 0.00099
Further Details:      
 
Domain Number 5 Region: 261-334,370-392
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000216
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221316650|ref|NP_005223.4|
Sequence length 976
Comment ephrin type-A receptor 1 precursor [Homo sapiens]
Sequence
MERRWPLGLGLVLLLCAPLPPGARAKEVTLMDTSKAQGELGWLLDPPKDGWSEQQQILNG
TPLYMYQDCPMQGRRDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKE
TFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLVSGSVKLNVERCSLGRLTRRG
LYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGTCLPHARASPR
PSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGEACVACPSGSYRMDMDTPHCLTCPQQ
STAESEGATICTCESGHYRAPGEGPQVACTGPPSAPRNLSFSASGTQLSLRWEPPADTGG
RQDVRYSVRCSQCQGTAQDGGPCQPCGVGVHFSPGARGLTTPAVHVNGLEPYANYTFNVE
AQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLT
YELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVS
RGLTGGEIVAVIFGLLLGAALLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKPYV
DLQAYEDPAQGALDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKD
TSPGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDAFLREREDQ
LVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLCCKVSDFGLTRLLDDFDGT
YETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIE
DGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQLLANPHSLRTIANFDPRM
TLRLPSLSGSDGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITL
PGHQKRILCSIQGFKD
Download sequence
Identical sequences P21709
gi|221316650|ref|NP_005223.4| 9606.ENSP00000275815 ENSP00000275815 NP_005223.4.87134 NP_005223.4.92137 ENSP00000275815 ENSP00000275815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]