SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221316674|ref|NP_001138301.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221316674|ref|NP_001138301.1|
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0055
Further Details:      
 
Domain Number 2 Region: 313-416
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000367
Family FAD/NAD-linked reductases, N-terminal and central domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221316674|ref|NP_001138301.1|
Sequence length 464
Comment dimethylaniline monooxygenase [N-oxide-forming] 5 isoform 2 [Homo sapiens]
Sequence
MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
ATSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
EGFTGKRVIIIGIGNSGGDLAVEISQTAKQVFLSTRRGAWILNRVGDYGYPADVLFSSRL
THFIWKICGQSLANKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKV
KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKISLYKKVFPPN
LERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKSL
TMRKTSDKPKLKNILQIPDYLKTVKIINKESLRNCPGIKGPKET
Download sequence
Identical sequences NP_001138301.1.87134 NP_001138301.1.92137 gi|221316674|ref|NP_001138301.1| ENSP00000416011 ENSP00000416011 ENSP00000462062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]