SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221625401|ref|NP_004430.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221625401|ref|NP_004430.4|
Domain Number 1 Region: 669-949
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-83
Family Protein kinases, catalytic subunit 0.000000000809
Further Details:      
 
Domain Number 2 Region: 60-232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-71
Family Ephrin receptor ligand binding domain 0.00000132
Further Details:      
 
Domain Number 3 Region: 357-560
Classification Level Classification E-value
Superfamily Fibronectin type III 2.84e-40
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 965-1032
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.45e-21
Family SAM (sterile alpha motif) domain 0.00051
Further Details:      
 
Weak hits

Sequence:  gi|221625401|ref|NP_004430.4|
Domain Number - Region: 275-354,390-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000334
Family Growth factor receptor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|221625401|ref|NP_004430.4|
Sequence length 1037
Comment ephrin type-A receptor 5 isoform a precursor [Homo sapiens]
Sequence
MRGSGPRGAGRRRPPSGGGDTPITPASLAGCYSAPRRAPLWTCLLLCAALRTLLASPSNE
VNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISN
EGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDQNGRNIKENQYIKIDTIAAD
ESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHL
AVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNG
TCQVCRPGFFKASPHIQSCGKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSA
PRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGGHVRYLPRQSG
LKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKI
AKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQI
RARTAAGYGVFSRRFEFETTPVFAASSDQSQIPVIAVSVTVGVILLAVVIGVLLSGSCCE
CGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPN
QAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRD
FLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGM
LRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKI
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSP
MDCPAALYQLMLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHS
PLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIM
NSLQEMKVQLVNGMVPL
Download sequence
Identical sequences P54756
ENSP00000273854 ENSP00000273854 NP_004430.4.87134 NP_004430.4.92137 9606.ENSP00000273854 ENSP00000273854 gi|221625401|ref|NP_004430.4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]