SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22202629|ref|NP_665811.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22202629|ref|NP_665811.1|
Domain Number 1 Region: 474-604
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.68e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 123-343
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.44e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000466
Further Details:      
 
Domain Number 3 Region: 295-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22202629|ref|NP_665811.1|
Sequence length 609
Comment apoptosis-inducing factor 1, mitochondrial isoform 2 precursor [Homo sapiens]
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPVVQSHHLGSPSRSLASTGASGKDGS
NLVYFLIVGATVTGAGVYYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVP
QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDD
PNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVK
LNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSIT
IIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVM
PNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVN
AELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWS
DLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIP
PSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEV
AKLFNIHED
Download sequence
Identical sequences ENSP00000315122 ENSP00000315122 NP_665811.1.87134 NP_665811.1.92137 gi|22202629|ref|NP_665811.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]