SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22208951|ref|NP_665862.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22208951|ref|NP_665862.1|
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-58
Family Ankyrin repeat 0.0000872
Further Details:      
 
Domain Number 2 Region: 379-429
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000536
Family SOCS box-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22208951|ref|NP_665862.1|
Sequence length 445
Comment ankyrin repeat and SOCS box protein 3 isoform b [Homo sapiens]
Sequence
MKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPLFLAVENGQIDVLRLLLQ
HGANVNGSHSMCGWNSLHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLE
SLSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHA
AAQMGHTKILDLLIPLTNRACDTGLNKVSPVYSAVFGGHEDCLEILLRNGYSPDAQACLV
FGFSSPVCMAFQKDCEFFGIVNILLKYGAQINELHLAYCLKYEKFSIFRYFLRKGCSLGP
WNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNSWIDSVSIDTLIFTLEFTNWKT
LAPAVERMLSARASNAWILQQHIATVPSLTHLCRLEIRSSLKSERLRSDSYISQLPLPRS
LHNYLLYEDVLRMYEVPELAAIQDG
Download sequence
Identical sequences A0A2I2ZE80
ENSP00000378206 ENSP00000384728 gi|22208951|ref|NP_665862.1| gi|320202950|ref|NP_001188894.1| ENSP00000378206 ENSP00000384728 NP_001188894.1.87134 NP_001188894.1.92137 NP_665862.1.87134 NP_665862.1.92137 XP_004029277.1.27298 XP_018876627.1.27298 XP_018876628.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]