SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22208957|ref|NP_078977.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22208957|ref|NP_078977.2|
Domain Number 1 Region: 18-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-58
Family Ankyrin repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 235-277
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000102
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22208957|ref|NP_078977.2|
Sequence length 278
Comment ankyrin repeat and SOCS box protein 13 [Homo sapiens]
Sequence
MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAAS
LQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASP
LHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAK
LHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPL
TLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
Download sequence
Identical sequences Q8WXK3
NP_078977.2.87134 NP_078977.2.92137 ENSP00000350331 gi|22208957|ref|NP_078977.2| ENSP00000350331 ENSP00000350331 9606.ENSP00000350331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]