SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22208964|ref|NP_665879.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22208964|ref|NP_665879.1|
Domain Number 1 Region: 22-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.32e-48
Family Ankyrin repeat 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22208964|ref|NP_665879.1|
Sequence length 349
Comment ankyrin repeat and SOCS box protein 4 isoform b [Homo sapiens]
Sequence
MDGTTAPVTKSGAAKLVKRNFLEALKSNDFGKLKAILIQRQIDVDTVFEVEDENMVLASY
KQGYWLPSYKLKSSWATGLHLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANV
DCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLH
TAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEHHLVCRMLLD
YKAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRP
AAQPEICYQLLLNHGAARIYPPQFHKVRLCPVVSRLRKIQMAALSEISK
Download sequence
Identical sequences A0A2J8L4E0 A0A2J8WJN6
NP_665879.1.87134 NP_665879.1.92137 ENSP00000397070 gi|22208964|ref|NP_665879.1| ENSP00000397070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]