SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22212934|ref|NP_671513.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22212934|ref|NP_671513.1|
Domain Number - Region: 23-53
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0288
Family Gelsolin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22212934|ref|NP_671513.1|
Sequence length 192
Comment sigma non-opioid intracellular receptor 1 isoform 2 [Homo sapiens]
Sequence
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGET
VVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLR
LELTTYLFGQDP
Download sequence
Identical sequences A0A2I2Z1Q6 A0A2I3GY95 A0A2I3N7X4 A0A2J8T0P3 A0A2K5KFU7 A0A2K5NAU8 A0A2K6D7E9 A0A2K6KES0 A0A2K6N988 A2A3U5 F7HC82 K7D8P3
ENSMMUP00000027342 gi|22212934|ref|NP_671513.1| ENSP00000420022 ENSP00000420022 NP_671513.1.87134 NP_671513.1.92137 XP_001163780.1.37143 XP_003263437.1.23891 XP_011805900.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]