SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222352168|ref|NP_001138432.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222352168|ref|NP_001138432.1|
Domain Number 1 Region: 158-300
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000793
Family Ankyrin repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000143
Family Ubiquitin-related 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|222352168|ref|NP_001138432.1|
Domain Number - Region: 105-154
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00507
Family Ubiquitin-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222352168|ref|NP_001138432.1|
Sequence length 544
Comment protein ANKUB1 [Homo sapiens]
Sequence
MRIFIAFEGSFEPFDVSADETVEVVKLMIKDYFHIPLSEDKQGRRYLELMYAGAALKDSW
SLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQDTMPVMESISLLDKTVSDLRTLVTLRC
GLPVSVYCLRTPRGLEMYDCNTLKDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKLKVQRY
LSKEGPVLKYQKRVALYIAAFCGYIELTEWALKQGARPHEAVGVHPYRAWCHEALHADVS
KCPIHAAAEAGQLLILKAFVNYSVLCLECKNAAGQTPLTIVFKHKHKDCVLYLLSKMWST
VSFPKISVPMRIYIKIKQWILRAQSHSLHKSQFCGARVFGAKVGDTVMVDGFTKPKMTSK
SWHKAGNSDSQSIVLKLPSLSKQTASSKPVNPLAISQPDTRKQALKFHPLVNASSFSELQ
KHQQQNQKKITATARKKEKLIKNTYLPQVPLPPVSRVGYSHPSFFYATPSADFLLKSSFS
SFLEHSGKTPWENAIYCLAVASAFKEKRWLQQLEIARVLAKKSISNLTTRGGLTACENSL
ETVL
Download sequence
Identical sequences E9PHT4
ENSP00000387907 ENSP00000387907 gi|222352168|ref|NP_001138432.1| HR5622 NP_001138432.1.87134 NP_001138432.1.92137 ENSP00000417635 9606.ENSP00000387907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]