SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222352179|ref|NP_001138435.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222352179|ref|NP_001138435.1|
Domain Number 1 Region: 35-117
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000234
Family Ankyrin repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222352179|ref|NP_001138435.1|
Sequence length 343
Comment NF-kappa-B inhibitor-like protein 1 isoform 4 [Homo sapiens]
Sequence
MASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLDVDAGQPPPLHRACARHDAPALCL
LLRLGADPAHQDRHGDTALHAAARQGPDAYTDFFLPLLSRCPSAMGIKNKDGETPGQILG
WGPPWDSAEEEEEDDASKEREWRQKLQGDASHETQEPESFSAWSDRLAREHAQKCQQQQR
EAEGSRRPPRAEGSSQSWRQQEEEQRLFRERARAKEEELRESRARRAQEALGDREPKPTR
AGPREEHPRGAGRGSLWRFGDVPWPCPGGGDPEAMAAALVARGPPLEEQGALRRYLRVQQ
VRWHPDRFLQRFRSQIETWELGRVMGAVTALSQALNRHAEALK
Download sequence
Identical sequences NP_001138435.1.87134 NP_001138435.1.92137 gi|222352179|ref|NP_001138435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]