SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222831592|ref|NP_001036040.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222831592|ref|NP_001036040.2|
Domain Number 1 Region: 475-713
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-79
Family Eukaryotic proteases 0.0000558
Further Details:      
 
Domain Number 2 Region: 1-120
Classification Level Classification E-value
Superfamily SEA domain 6.54e-20
Family SEA domain 0.0069
Further Details:      
 
Domain Number 3 Region: 120-233
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000327
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 4 Region: 248-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000615
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 5 Region: 355-392
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 432-471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 391-427
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000314
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222831592|ref|NP_001036040.2|
Sequence length 717
Comment transmembrane protease serine 7 [Homo sapiens]
Sequence
MFRITNIEFLPEYRQKESREFLSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSNNKGGL
LVHFWIVFVMPRAKGHIFCEDCVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNDKG
CSQYFYAEHLSLHYPLEISAASGRLMCHFKLVAIVGYLIRLSIKSIQIEADNCVTDSLTI
YDSLLPIRSSILYRICEPTRTLMSFVSTNNLMLVTFKSPHIRRLSGIRAYFEVIPEQKCE
NTVLVKDITGFEGKISSPYYPSYYPPKCKCTWKFQTSLSTLGIALKFYNYSITKKSMKGC
EHGWWEINEHMYCGSYMDHQTIFRVPSPLVHIQLQCSSRLSDKPLLAEYGSYNISQPCPV
GSFRCSSGLCVPQAQRCDGVNDCFDESDELFCVSPQPACNTSSFRQHGPLICDGFRDCEN
GRDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCDGTVDCPDGSDEEGCTCSRSSSALHRI
IGGTDTLEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMY
VQGNAKFVSPVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPTGQRVRS
GEKCWVTGWGRRHEADNKGSLVLQQAEVELIDQTLCVSTYGIITSRMLCAGIMSGKRDAC
KGDSGGPLSCRRKSDGKWILTGIVSWGHGSGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences 9606.ENSP00000409022 NP_001036040.2.87134 NP_001036040.2.92137 ENSP00000411645 gi|222831592|ref|NP_001036040.2| ENSP00000411645 ENSP00000478830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]