SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|223005864|ref|NP_937791.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223005864|ref|NP_937791.2|
Domain Number 1 Region: 314-643
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.26e-70
Family Pancreatic carboxypeptidases 0.00000204
Further Details:      
 
Domain Number 2 Region: 135-296
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.62e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00014
Further Details:      
 
Domain Number 3 Region: 643-731
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.46e-20
Family Carboxypeptidase regulatory domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|223005864|ref|NP_937791.2|
Sequence length 756
Comment inactive carboxypeptidase-like protein X2 precursor [Homo sapiens]
Sequence
MSRPGTATPALALVLLAVTLAGVGAQGAALEDPDYYGQEIWSREPYYARPEPELETFSPP
LPAGPGEEWERRPQEPRPPKRATKPKKAPKREKSAPEPPPPGKHSNKKVMRTKSSEKAAN
DDHSVRVAREDVRESCPPLGLETLKITDFQLHASTVKRYGLGAHRGRLNIQAGINENDFY
DGAWCAGRNDLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVK
NGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWFDNGSICMRMEILGCPLPDPNN
YYHRRNEMTTTDDLDFKHHNYKEMRQLMKVVNEMCPNITRIYNIGKSHQGLKLYAVEISD
HPGEHEVGEPEFHYIAGAHGNEVLGRELLLLLVQFVCQEYLARNARIVHLVEETRIHVLP
SLNPDGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNTLLWEAEDRQNVPRKVPNHY
IAIPEWFLSENATVAAETRAVIAWMEKIPFVLGGNLQGGELVVAYPYDLVRSPWKTQEHT
PTPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKEEGTVNGASWHTVAGSLNDFSYL
HTNCFELSIYVGCDKYPHESQLPEEWENNRESLIVFMEQVHRGIKGLVRDSHGKGIPNAI
ISVEGINHDIRTANDGDYWRLLNPGEYVVTAKAEGFTASTKNCMVGYDMGATRCDFTLSK
TNMARIREIMEKFGKQPVSLPARRLKLRGQKRRQRG
Download sequence
Identical sequences Q8N436
9606.ENSP00000241305 NP_937791.2.87134 NP_937791.2.92137 ENSP00000241305 ENSP00000241305 gi|223005864|ref|NP_937791.2| ENSP00000241305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]