SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22325388|ref|NP_680474.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22325388|ref|NP_680474.1|
Domain Number 1 Region: 106-283
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.23e-63
Family F-box associated region, FBA 0.0000234
Further Details:      
 
Domain Number 2 Region: 17-78
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000196
Family F-box domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|22325388|ref|NP_680474.1|
Sequence length 287
Comment F-box only protein 17 isoform 1 [Homo sapiens]
Sequence
MKQGLWLLEMGARLSRRRLPADPSLALDALPPELLVQVLSHVPPRSLVTRCRPVCRAWRD
IVDGPTVWLLQLARDRSAEGRALYAVAQRCLPSNEDKEEFPLCALARYCLRAPFGRNLIF
NSCGEQGFRGWEVEHGGNGWAIEKNLTPVPGAPSQTCFVTSFEWCSKRQLVDLVMEGVWQ
ELLDSAQIEICVADWWGARENCGCVYQLRVRLLDVYEKEVVKFSASPDPVLQWTERGCRQ
VSHVFTNFGKGIRYVSFEQYGRDVSSWVGHYGALVTHSSVRVRIRLS
Download sequence
Identical sequences NP_680474.1.87134 NP_680474.1.92137 gi|22325388|ref|NP_680474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]