SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|223634006|ref|NP_001138682.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223634006|ref|NP_001138682.1|
Domain Number 1 Region: 40-363
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.77e-76
Family Ankyrin repeat 0.00000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223634006|ref|NP_001138682.1|
Sequence length 399
Comment hypothetical protein LOC441869 [Homo sapiens]
Sequence
MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQL
LRQGASVEERDHAGRTPLHLAVLRGHAPLVRLLLQRGAPVGAVDRAGRTALHEAAWHGHS
RVAELLLQRGASAAARSGTGLTPLHWAAALGHTLLAARLLEAPGPGPAAAEAEDARGWTA
AHWAAAGGRLAVLELLAAGGAGLDGALLVAAAAGRGAALRFLLARGARVDARDGAGATAL
GLAAALGRSQDIEVLLGHGADPGIRDRHGRSALHRAAARGHLLAVQLLVTQGAEVDARDT
LGLTPLHHASREGHVEVAGCLLDRGAQVDATGWLRKTPLHLAAERGHGPTVGLLLSRGAS
PTLRTQWAEVAQMPEGDLPQALPELGGGEKECEGIESTG
Download sequence
Identical sequences E5RJM6
ENSP00000429035 ENSP00000445688 ENSP00000445688 ENSP00000482314 gi|223634006|ref|NP_001138682.1| NP_001138682.1.87134 NP_001138682.1.92137 XP_005244809.1.92137 XP_006710710.1.92137 XP_011539791.1.92137 XP_016856813.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]