SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|223718207|ref|NP_001138784.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223718207|ref|NP_001138784.1|
Domain Number 1 Region: 33-169
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.42e-47
Family ets domain 0.0000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223718207|ref|NP_001138784.1|
Sequence length 512
Comment ETS translocation variant 3 isoform 1 [Homo sapiens]
Sequence
MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGE
YGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKL
VMPNYPFINIRSSGVVPQSAPPVPTASSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQE
SSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKRKPDIMLPLFARPGMY
PDPHSPFAVSPIPGRGGVLNVPISPALSLTPTIFSYSPSPGLSPFTSSSCFSFNPEEMKH
YLHSQACSVFNYHLSPRTFPRYPGLMVPPLQCQMHPEESTQFSIKLQPPPVGRKNRERVE
SSEESAPVTTPTMASIPPRIKVEPASEKDPESLRQSAREKEEHTQEEGTVPSRTIEEEKG
TIFARPAAPPIWPSVPISTPSGEPLEVTEDSEDRPGKEPSAPEKKEDALMPPKLRLKRRW
NDDPEARELSKSGKFLWNGSGPQGLATAAADA
Download sequence
Identical sequences P41162
gi|223718207|ref|NP_001138784.1| NP_001138784.1.87134 NP_001138784.1.92137 XP_006711273.1.92137 9606.ENSP00000357175 ENSP00000357175 ENSP00000327316 ENSP00000357175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]