SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|223941803|ref|NP_001138766.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223941803|ref|NP_001138766.1|
Domain Number 1 Region: 130-405
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-94
Family Transglutaminase core 0.000000000142
Further Details:      
 
Domain Number 2 Region: 435-611
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2e-62
Family Extended PAW domain 0.0000000613
Further Details:      
 
Domain Number 3 Region: 2-74
Classification Level Classification E-value
Superfamily PUG domain-like 1.06e-21
Family PUG domain 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|223941803|ref|NP_001138766.1|
Sequence length 612
Comment peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase isoform 3 [Homo sapiens]
Sequence
MRNPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIR
DLIAIERSSRLDGSNKSHKVKSSQQPAASTQLPTTPSSNPSGLNQHTRNRQGQSSDPPSA
STVAADSAILEVLQSNIQHVLVYENPALQEKALACIPVQELKRKSQEKLSRARKLDKGIN
ISDEDFLLLELLHWFKEEFFHWVNNVLCSKCGGQTRSRDRSLLPSDDELKWGAKEVEDHY
CDACQFSNRFPRYNNPEKLLETRCGRCGEWANCFTLCCRAVGFEARYVWDYTDHVWTEVY
SPSQQRWLHCDACEDVCDKPLLYEIGWGKKLSYVIAFSKDEVVDVTWRYSCKHEEVIARR
TKVKEALLRDTINGLNKQRQLFLSENRRKELLQRIIVELVEFISPKTPKPGELGGRISGS
VAWRVARGEMGLQRKETLFIPCENEKISKQLHLCYNIVKDRYVRVSNNNQTISGWENGVW
KMESIFRKVETDWHMVYLARKEGSSFAYISWKFECGSVGLKVDSISIRTSSQTFQTGTVE
WKLRSDTAQVELTGDNSLHSYADFSGATEVILEAELSRGDGDVAWQHTQLFRQSLNDHEE
NCLEIIIKFSDL
Download sequence
Identical sequences gi|223941803|ref|NP_001138766.1| ENSP00000389888 ENSP00000389888 NP_001138766.1.87134 NP_001138766.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]