SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|223942069|ref|NP_002763.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223942069|ref|NP_002763.2|
Domain Number 1 Region: 764-1018
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-89
Family Eukaryotic proteases 0.0000000373
Further Details:      
 
Domain Number 2 Region: 344-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-38
Family MAM domain 0.0089
Further Details:      
 
Domain Number 3 Region: 523-633
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 4 Region: 231-335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-18
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 5 Region: 59-164
Classification Level Classification E-value
Superfamily SEA domain 2.09e-16
Family SEA domain 0.0071
Further Details:      
 
Domain Number 6 Region: 673-774
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000105
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 
Domain Number 7 Region: 640-678
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000929
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 183-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000641
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|223942069|ref|NP_002763.2|
Sequence length 1019
Comment enteropeptidase precursor [Homo sapiens]
Sequence
MGSKRGISSRHHSLSSYEIMFAALFAILVVLCAGLIAVSCLTIKESQRGAALGQSHEARA
TFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSII
VVFDLFFAQWVSDENVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATPGNV
SIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQA
THYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDILDIYEGVGSSKILRASIWETN
PGTIRIFSNQVTATFLIESDESDYVGFNATYTAFNSSELNNYEKINCNFEDGFCFWVQDL
NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEP
ACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKVAFN
AFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSST
NFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPG
PVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVN
LCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWTTQISNDVCQLLG
LGSGNSSKPIFSTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLAAQD
ITPKIVGGSNAKEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAI
LGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPICLPEE
NQVFPPGRNCSIAGWGTVVYQGTTANILQEADVPLLSNERCQQQMPEYNITENMICAGYE
EGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH
Download sequence
Identical sequences NP_002763.2.87134 NP_002763.2.92137 gi|223942069|ref|NP_002763.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]