SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|223972688|ref|NP_631913.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|223972688|ref|NP_631913.3|
Domain Number 1 Region: 114-141,212-256
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000683
Family Double-stranded RNA-binding domain (dsRBD) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|223972688|ref|NP_631913.3|
Sequence length 665
Comment adenosine deaminase domain-containing protein 2 isoform 1 [Homo sapiens]
Sequence
MASASQGADDDGSRRKPRLAASLQISPQPRPWRPLPAQAQSAWGPAPAPATYRAEGGWPQ
VSVLRDSGPGAGAGVGELGAARAWENLGEQMGKAPRVPVPPAGLSLPLKDPPASQAVSLL
TEYAASLGIFLLFREDQPPGKVFKYRAPGGEELKAMCLWQVEVLRAFLLRTGWRGLWRGD
LDLGPDSSWANRLPFLLICEMESRIPAVEELGPCFPFSVSAELDGVVCPAGTANSKTEAK
QQAALSALCYIRSQLENPESPQTSSRPPLAPLSVENILTHEQRCAALVSAGFDLLLDERS
PYWACKGTVAGVILERGWAVSAPSCTEIPRARGHVKEIYKLVALGTGSSCCAGWLEFSGQ
QLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPPFTLKPRVFLHLY
ISNTPKGAARDIYLPPTSEGGLPHSPPMRLQAHVLGQLKPVCYVAPSLCDTHVGCLSASD
KLARWAVLGLGGALLAHLVSPLYSTSLILADSCHDPPTLSRAIHTRPCLDSVLGPCLPPP
YVRTALHLFAGPPVAPSEPTPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRL
CKASFLRAFHQAARAVGKPYLLALKTYEAAKAGPYQEARRQLSLLLDQQGLGAWPSKPLV
GKFRN
Download sequence
Identical sequences ENSP00000268624 gi|223972688|ref|NP_631913.3| 9606.ENSP00000268624 NP_631913.3.87134 NP_631913.3.92137 ENSP00000268624 ENSP00000268624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]