SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|224809470|ref|NP_001138992.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224809470|ref|NP_001138992.1|
Domain Number 1 Region: 21-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.79e-62
Family Ankyrin repeat 0.00019
Further Details:      
 
Weak hits

Sequence:  gi|224809470|ref|NP_001138992.1|
Domain Number - Region: 428-507
Classification Level Classification E-value
Superfamily Tropomyosin 0.000405
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number - Region: 845-951
Classification Level Classification E-value
Superfamily t-snare proteins 0.00188
Family t-snare proteins 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|224809470|ref|NP_001138992.1|
Sequence length 980
Comment ankycorbin isoform a [Homo sapiens]
Sequence
MKSLKAKFRKSDTNEWNKNDDRLLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLA
AAKGHVECLRVMITHGVDVTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGK
TALHYAAAQGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNS
RNKSGRTALMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSK
ISQDADLKTPTKPKQHDQVSKISSERSGTPKKRKAPPPPISPTQLSDVSSPRSITSTPLS
GKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLT
LHNKELQDKLQAKSPKEAEADLSFDSYHSTQTDLGPSLGKPGETSPPDSKSSPSVLIHSL
GKSTTDNDVRIQQLQEILQDLQKRLESSEAERKQLQVELQSRRAELVCLNNTEISENSSD
LSQKLKETQSKYEEAMKEVLSVQKQMKLGLVSPESMDNYSHFHELRVTEEEINVLKQDLQ
NALEESERNKEKVRELEEKLVEREKGTVIKPPVEEYEEMKSSYCSVIENMNKEKAFLFEK
YQEAQEEIMKLKDTLKSQMTQEASDEAEDMKEAMNRMIDELNKQVSELSQLYKEAQAELE
DYRKRKSLEDVTAEYIHKAEHEKLMQLTNVSRAKAEDALSEMKSQYSKVLNELTQLKQLV
DAQKENSVSITEHLQVITTLRTAAKEMEEKISNLKEHLASKEVEVAKLEKQLLEEKAAMT
DAMVPRSSYEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQT
LLKSKEQEVNELLQKFQQAQEELAEMKRYAESSSKLEEDKDKKINEMSKEVTKLKEALNS
LSQLSYSTSSSKRQSQQLEALQQQVKQLQNQLAECKKQHQEVISVYRMHLLYAVQGQMDE
DVQKVLKQILTMCKNQSQKK
Download sequence
Identical sequences Q9P0K7
NP_001138992.1.87134 NP_001138992.1.92137 NP_001138993.1.87134 NP_001138993.1.92137 NP_056392.2.87134 NP_056392.2.92137 XP_006714532.1.92137 XP_011512319.1.92137 XP_011512320.1.92137 XP_011512321.1.92137 XP_011512322.1.92137 XP_011512323.1.92137 XP_011512324.1.92137 9606.ENSP00000265109 gi|224809468|ref|NP_056392.2| gi|224809470|ref|NP_001138992.1| gi|224809472|ref|NP_001138993.1| ENSP00000265109 ENSP00000388725 ENSP00000422942 ENSP00000265109 ENSP00000388725 ENSP00000422942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]