SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|224809476|ref|NP_001138995.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224809476|ref|NP_001138995.1|
Domain Number 1 Region: 13-232
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.46e-62
Family Ankyrin repeat 0.00019
Further Details:      
 
Weak hits

Sequence:  gi|224809476|ref|NP_001138995.1|
Domain Number - Region: 420-499
Classification Level Classification E-value
Superfamily Tropomyosin 0.000405
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number - Region: 837-943
Classification Level Classification E-value
Superfamily t-snare proteins 0.00165
Family t-snare proteins 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|224809476|ref|NP_001138995.1|
Sequence length 972
Comment ankycorbin isoform c [Homo sapiens]
Sequence
MEAKTNEWNKNDDRLLQAVENGDAEKVASLLGKKGASATKHDSEGKTAFHLAAAKGHVEC
LRVMITHGVDVTAQDTTGHSALHLAAKNSHHECIRKLLQSKCPAESVDSSGKTALHYAAA
QGCLQAVQILCEHKSPINLKDLDGNIPLLLAVQNGHSEICHFLLDHGADVNSRNKSGRTA
LMLACEIGSSNAVEALIKKGADLNLVDSLGYNALHYSKLSENAGIQSLLLSKISQDADLK
TPTKPKQHDQVSKISSERSGTPKKRKAPPPPISPTQLSDVSSPRSITSTPLSGKESVFFA
EPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLTLHNKELQD
KLQAKSPKEAEADLSFDSYHSTQTDLGPSLGKPGETSPPDSKSSPSVLIHSLGKSTTDND
VRIQQLQEILQDLQKRLESSEAERKQLQVELQSRRAELVCLNNTEISENSSDLSQKLKET
QSKYEEAMKEVLSVQKQMKLGLVSPESMDNYSHFHELRVTEEEINVLKQDLQNALEESER
NKEKVRELEEKLVEREKGTVIKPPVEEYEEMKSSYCSVIENMNKEKAFLFEKYQEAQEEI
MKLKDTLKSQMTQEASDEAEDMKEAMNRMIDELNKQVSELSQLYKEAQAELEDYRKRKSL
EDVTAEYIHKAEHEKLMQLTNVSRAKAEDALSEMKSQYSKVLNELTQLKQLVDAQKENSV
SITEHLQVITTLRTAAKEMEEKISNLKEHLASKEVEVAKLEKQLLEEKAAMTDAMVPRSS
YEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQE
VNELLQKFQQAQEELAEMKRYAESSSKLEEDKDKKINEMSKEVTKLKEALNSLSQLSYST
SSSKRQSQQLEALQQQVKQLQNQLAECKKQHQEVISVYRMHLLYAVQGQMDEDVQKVLKQ
ILTMCKNQSQKK
Download sequence
Identical sequences ENSP00000423854 NP_001138995.1.87134 NP_001138995.1.92137 gi|224809476|ref|NP_001138995.1| ENSP00000423854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]