SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|226497574|ref|NP_057280.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|226497574|ref|NP_057280.2|
Domain Number 1 Region: 401-490,584-657
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.98e-34
Family Canonical RBD 0.0000156
Further Details:      
 
Domain Number 2 Region: 724-811
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.16e-26
Family Canonical RBD 0.0000467
Further Details:      
 
Domain Number 3 Region: 827-912
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.3e-21
Family Canonical RBD 0.00000804
Further Details:      
 
Domain Number 4 Region: 3-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.54e-21
Family Canonical RBD 0.0047
Further Details:      
 
Domain Number 5 Region: 286-369
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.84e-17
Family Canonical RBD 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|226497574|ref|NP_057280.2|
Sequence length 960
Comment probable RNA-binding protein 19 [Homo sapiens]
Sequence
MSRLIVKNLPNGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFKSEEEAQKAQK
HFNKSFIDTSRITVEFCKSFGDPAKPRAWSKHAQKPSQPKQPPKDSTTPEIKKDEKKKKV
AGQLEKLKEDTEFQEFLSVHQRRAQAATWANDGLDAEPSKGKSKPASDYLNFDSDSGQES
EEEGAGEDLEEEASLEPKAAVQKELSDMDYLKSKMVKAGSSSSSEEEESEDEAVHCDEGS
EAEEEDSSATPVLQERDSKGAGQEQGMPAGKKRPPEARAETEKPANQKEPTTCHTVKLRG
APFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGR
YIEVFREKNVPTTKGAPKNTTKSWQGRILGENEEEEDLAESGRLFVRNLPYTSTEEDLEK
LFSKYGPLSELHYPIDSLTKKPKGFAFITFMFPEHAVKAYSEVDGQVFQGRMLHVLPSTI
KKEASEDASALGSSSYKKKKEAQDKANSASSHNWNTLFMGPNAVADAIAQKYNATKSQVF
DHETKGSVAVRVALGETQLVQEVRRFLIDNGVSLDSFSQAAAERSKTVILVKNLPAGTLA
AQLQETFGHFGSLGRVLLPEGGITAIVEFLEPLEARKAFRHLAYSKFHHVPLYLEWAPVG
VFSSTAPQKKKLQDTPSEPMEKDPAEPETVPDGETPEDENPTEEGADNSSAKMEEEEEEE
EEEEESLPGCTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVE
YRKPEQAQKALKQLQGHVVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIP
FQAHSREIRELFSTFGELKTVRLPKKMTGTGTHRGFGFVDFLTKQDAKRAFNALCHSTHL
YGRRLVLEWADSEVTLQALRRKTAAHFHEPPKKKRSVVLDEILEQLEGSDSDSEEQTLQL
Download sequence
Identical sequences Q9Y4C8
NP_001140170.1.87134 NP_001140170.1.92137 NP_001140171.1.87134 NP_001140171.1.92137 NP_057280.2.87134 NP_057280.2.92137 ENSP00000261741 ENSP00000261741 ENSP00000376344 ENSP00000442053 gi|226497574|ref|NP_057280.2| gi|226497654|ref|NP_001140170.1| gi|226497734|ref|NP_001140171.1| 9606.ENSP00000261741 ENSP00000261741 ENSP00000376344 ENSP00000442053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]