SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22748713|ref|NP_689539.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22748713|ref|NP_689539.1|
Domain Number 1 Region: 117-198
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000108
Family Ankyrin repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22748713|ref|NP_689539.1|
Sequence length 317
Comment ankyrin repeat domain-containing protein 9 [Homo sapiens]
Sequence
MPWDARRPGGGADGGPEASGAARSRAQKQCRKSSFAFYQAVRDLLPVWLLEDMRASEAFH
WDERGRAAAYSPSEALLYALVHDHQAYAHYLLATFPRRALAPPSAGFRCCAAPGPHVALA
VRYNRVGILRRILRTLRDFPAEERARVLDRRGCSRVEGGGTSLHVACELARPECLFLLLG
HGASPGLRDGGGLTPLELLLRQLGRDAGATPSAAGAPASAPGEPRQRRLLLLDLLALYTP
VGAAGSARQELLGDRPRWQRLLGEDKFQWLAGLAPPSLFARAMQVLVTAISPGRFPEALD
ELPLPPFLQPLDLTGKG
Download sequence
Identical sequences Q96BM1
NP_689539.1.87134 NP_689539.1.92137 XP_005267367.1.92137 XP_005267368.1.92137 ENSP00000286918 ENSP00000453650 ENSP00000454100 ENSP00000286918 ENSP00000286918 ENSP00000453650 ENSP00000454100 gi|22748713|ref|NP_689539.1| 9606.ENSP00000286918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]