SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22748757|ref|NP_689562.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|22748757|ref|NP_689562.1|
Domain Number 1 Region: 67-144
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.32e-20
Family Intermediate filament protein, coiled coil region 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|22748757|ref|NP_689562.1|
Sequence length 295
Comment keratin-like protein KRT222 [Homo sapiens]
Sequence
MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARR
QWHHLQVEIESLHAVERGLENSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQ
EHEMLLNTKMRLEQEIATYRHLLEKEEIRYYGCIQGGKKDKKPTTSRVGFVLPSAIINEI
SFTTKVPQKYENENVETVTKQAILNGSIVKESTEAHGTIQTEKVDEVIKEWEGSFFKDNP
RLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMRRSCSIPSIKPPSTAN
Download sequence
Identical sequences Q8N1A0
ENSP00000377616 ENSP00000463483 GO.43903 ENSP00000377616 ENSP00000463483 NP_689562.1.87134 NP_689562.1.92137 9606.ENSP00000377616 gi|22748757|ref|NP_689562.1| ENSP00000377613 ENSP00000463483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]