SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|22749429|ref|NP_689936.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|22749429|ref|NP_689936.1|
Domain Number - Region: 231-298
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0706
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|22749429|ref|NP_689936.1|
Sequence length 374
Comment coiled-coil domain-containing protein 89 [Homo sapiens]
Sequence
MRAPMLQKQQAPRMDTPPPEERLEKQNEKLNNQEEETEFKELDGLREALANLRGLSEEER
SEKAMLRSRIEEQSQLICILKRRSDEALERCQILELLNAELEEKMMQEAEKLKAQGEYSR
KLEERFMTLAANHELMLRFKDEYKSENIKLREENEKLRLENSSLFSQALKDEEAKVLQLT
VRCEALTGELETLKERCAQDACQAQAREKELLELQSQQACTHTKETEQLRSQLQTLKQQH
QQAVEQIAKAEETHSSLSQELQARLQTVTREKEELLQLSIERGKVLQNKQAEICQLEEKL
EIANEDRKHALERFEQEAVAVDSNLRVRELQRKVDGIQKAYDELRLQSEAFKKHSLDLLS
KERELNGKLRHLSP
Download sequence
Identical sequences Q8N998
ENSP00000320649 gi|22749429|ref|NP_689936.1| NP_689936.1.87134 NP_689936.1.92137 9606.ENSP00000320649 ENSP00000320649 ENSP00000320649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]