SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|227498241|ref|NP_110439.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227498241|ref|NP_110439.2|
Domain Number 1 Region: 141-363
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.15e-53
Family Actin/HSP70 0.0000475
Further Details:      
 
Domain Number 2 Region: 4-148
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.77e-34
Family Actin/HSP70 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|227498241|ref|NP_110439.2|
Sequence length 366
Comment actin-like protein 8 [Homo sapiens]
Sequence
MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHP
DTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFE
LLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDL
SAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQL
PDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGG
NTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEY
GEHMRM
Download sequence
Identical sequences Q9H568
NP_110439.2.87134 NP_110439.2.92137 XP_011540514.1.92137 9606.ENSP00000235799 ENSP00000364555 gi|227498241|ref|NP_110439.2| ENSP00000364555 ENSP00000481590 ENSP00000364555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]