SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|227499990|ref|NP_001128571.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227499990|ref|NP_001128571.1|
Domain Number 1 Region: 279-526
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.12e-84
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 183-284
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.072
Further Details:      
 
Domain Number 3 Region: 149-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|227499990|ref|NP_001128571.1|
Domain Number - Region: 42-100
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00837
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|227499990|ref|NP_001128571.1|
Sequence length 529
Comment transmembrane protease serine 2 isoform 1 [Homo sapiens]
Sequence
MPPAPPGGESGCEERGAAGHIEHSRYLSLLDAVDNSKMALNSGSPPAIGPYYENHGYQPE
NPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKK
ALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGE
DENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDD
SGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESAL
PGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYG
AGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISG
WGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGG
PLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
Download sequence
Identical sequences ENSP00000391784 ENSP00000381588 ENSP00000381588 gi|227499990|ref|NP_001128571.1| NP_001128571.1.87134 NP_001128571.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]