SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23111026|ref|NP_037455.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23111026|ref|NP_037455.2|
Domain Number 1 Region: 13-128
Classification Level Classification E-value
Superfamily PX domain 2.22e-32
Family PX domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|23111026|ref|NP_037455.2|
Sequence length 270
Comment sorting nexin-11 [Homo sapiens]
Sequence
MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRY
REFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDS
QLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKS
CCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEG
TSTLQSVRRAVGGDHAVPLDPGQLETVLEK
Download sequence
Identical sequences Q9Y5W9
ENSP00000352175 gi|23111026|ref|NP_037455.2| gi|23111028|ref|NP_689450.1| 9606.ENSP00000352175 hss001000904.1 ENSP00000352175 ENSP00000377059 NP_037455.2.87134 NP_037455.2.92137 NP_689450.1.87134 NP_689450.1.92137 XP_005257317.1.92137 XP_011522999.1.92137 ENSP00000352175 ENSP00000377059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]