SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|23111030|ref|NP_037478.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|23111030|ref|NP_037478.2|
Domain Number 1 Region: 25-149
Classification Level Classification E-value
Superfamily PX domain 1.57e-31
Family PX domain 0.0000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|23111030|ref|NP_037478.2|
Sequence length 162
Comment sorting nexin-12 [Homo sapiens]
Sequence
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPI
FKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERR
QGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVRQ
Download sequence
Identical sequences A0A096MKE2 A0A1D5QBG3 A0A1S3AJN4 A0A1S3GE52 A0A1U7SSC8 A0A250YAL9 A0A2I2V0R9 A0A2K5E7N6 A0A2K5I3L6 A0A2K5MR72 A0A2K5RE87 A0A2K5U5W5 A0A2K5XWT4 A0A2K6D5S9 A0A2K6F5Q7 A0A2K6PJP3 A0A2K6UU12 A6QR61 F2Z596 F7C0P1 G1QK75 G3I7K5 G3RUM8 G3TI09 G5BW34 H0WZL7 H2PVY2 I3MWD1 K7BFD5 K9IYD0 L5LNL7 Q3SYF1 Q6ZWQ5 S7NA53 U6CQN8
ENSBTAP00000010355 ENSMMUP00000040997 ENSLAFP00000014248 ENSOGAP00000008043 9600.ENSPPYP00000022885 9606.ENSP00000363392 9823.ENSSSCP00000013195 9913.ENSBTAP00000010355 9986.ENSOCUP00000012820 gi|23111030|ref|NP_037478.2| ENSBTAP00000010355 ENSP00000276105 ENSCJAP00000025160 NP_001096727.1.59421 NP_001096727.1.76553 NP_001103780.1.92730 NP_001180686.1.72884 NP_001243114.1.87134 NP_001243114.1.92137 NP_037478.2.87134 NP_037478.2.92137 XP_001085637.1.72884 XP_001928105.1.46622 XP_002831819.1.23681 XP_003272737.1.23891 XP_003412783.1.64505 XP_003511097.3.69978 XP_003640265.1.84170 XP_003820197.1.60992 XP_004000648.1.62641 XP_004064391.1.27298 XP_004275815.1.21590 XP_004380175.1.4749 XP_004380176.1.4749 XP_004396666.1.74151 XP_004595286.1.84141 XP_004621597.1.94378 XP_004646862.1.9945 XP_004694519.1.23501 XP_004777264.1.14098 XP_004872682.1.39548 XP_005340029.1.77405 XP_005358650.1.66349 XP_005401694.1.28644 XP_005700744.3.57651 XP_005876245.1.60319 XP_006076440.1.26621 XP_006082961.1.53796 XP_006217723.1.17985 XP_006767996.1.95426 XP_006868591.1.41390 XP_006896029.1.29581 XP_007114516.1.24612 XP_007183666.1.59432 XP_007470176.1.90284 XP_007536014.1.11023 XP_007607014.2.28591 XP_007957275.1.48129 XP_008047058.1.4292 XP_008565792.1.73410 XP_010354771.1.97406 XP_010971921.1.22495 XP_010977053.1.51371 XP_011369740.1.92234 XP_011731078.1.29376 XP_011798507.1.43180 XP_011798508.1.43180 XP_011847426.1.47321 XP_011916193.1.92194 XP_011997642.1.54773 XP_012330462.1.9421 XP_012499076.1.63892 XP_012591679.1.48125 XP_012668178.1.62490 XP_012887123.1.60039 XP_015299233.1.63531 XP_016006264.1.101085 XP_016062908.1.3490 XP_016799180.1.37143 XP_017372256.1.71028 XP_017525883.1.32401 XP_019284200.1.44245 XP_019804646.1.83887 XP_019811634.1.53367 XP_020006986.1.5219 XP_020738639.1.74333 XP_021517839.1.76796 ENSNLEP00000001320 HGL_H00000363399 ENSSSCP00000013195 ENSMUSP00000113117 ENSLAFP00000014248 ENSP00000363392 ENSP00000363392 ENSP00000481314 ENSPPYP00000022885 ENSSSCP00000013195 ENSOCUP00000012820 ENSGGOP00000019507 ENSPPYP00000022885 ENSOGAP00000008043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]